PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g009840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 405aa    MW: 45613.5 Da    PI: 4.8147
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g009840.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.53.8e-16341151398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++lv+p kf  +++ k   ++ +tl+++sg  ++vk+  +   ++  ++ GW +Fvk++ Lk +D +vFk++g sef   v +f+
  Csa11g009840.1  34 HHCLVIPQKFSIHCKRK--LPQIVTLKSPSGAIYNVKVEQDDVEKTLAFRCGWDKFVKDHSLKGNDLLVFKFHGVSEF--EVLIFD 115
                     556*******9999766..7889***************88888888*************************9998999..888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.06E-1921115IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.15322117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-1823115IPR015300DNA-binding pseudobarrel domain
CDDcd100175.00E-1824115No hitNo description
SMARTSM010194.7E-1725117IPR003340B3 DNA binding domain
PfamPF023621.1E-1334115IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEENCEDCMQ WEEELYWTHF QTLHFSQLLL PGFHHCLVIP QKFSIHCKRK LPQIVTLKSP  60
SGAIYNVKVE QDDVEKTLAF RCGWDKFVKD HSLKGNDLLV FKFHGVSEFE VLIFDGQTLC  120
ERPASYFVRK CGHADKTKGT DFTATSSRSP EIHFNPVDLE TTPNQQRLIT PPVVDNELED  180
LIDIDVEIDT MLTPRLVVSQ TGYDQEEHFN SDIDTASAQL PVISPTSTGR VSKEKYPLSG  240
LKKMRGEISN DSLDHKLGTD FTATSSRSPE IHFNPGDVET SPNQQRLISP PVVDINELED  300
LIDIDVEIDT MLTPRLVVSQ TGYDQEEHFN SDIDTASAQL PVISPTSTGR VSKEKYPFSG  360
LKKMRGEISN DSLDHKPGMK IFLLIDYTLH QFLGIHLICP VPGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0356780.0AL035678.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F17M5 (ESSA project).
GenBankAL1615830.0AL161583.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 79.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432581.10.0PREDICTED: B3 domain-containing protein REM16-like isoform X1
SwissprotQ8RYD11e-89REM16_ARATH; B3 domain-containing protein REM16
TrEMBLA0A087GJ881e-111A0A087GJ88_ARAAL; Uncharacterized protein
TrEMBLM4F7F01e-108M4F7F0_BRARP; Uncharacterized protein
STRINGBra037010.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104282335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.18e-91B3 family protein